ESF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ESF1 purified MaxPab rabbit polyclonal antibody (D01P)

ESF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051575-D01P
ESF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ESF1 protein.
Información adicional
Size 100 ug
Gene Name ESF1
Gene Alias ABTAP|C20orf6|FLJ20368|HDCMC28P|bA526K24.1
Gene Description ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSSKQEIMSDQRFRRVAKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTEDLKRFYDLSDSDSNLSGEDSKALSQKKIKKKKTQTKKEIDSKNLVEKKKETKKANHKGSENKTDLDNSIGIKKMKTSCKFKIDSNISPKKDSKEFTQKNKKEKKNIVQHTTDSSLEEKQRTLDSGTSEIVKSPRIECSKTRREMQSVVQLIMTRDSDGYENSTDGEMCDKDALEEDSESVSEIGSDEES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ESF1 (AAI46543.1, 1 a.a. ~ 851 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51575

Enviar un mensaje


ESF1 purified MaxPab rabbit polyclonal antibody (D01P)

ESF1 purified MaxPab rabbit polyclonal antibody (D01P)