MIR16 monoclonal antibody (M04), clone 2H6
  • MIR16 monoclonal antibody (M04), clone 2H6

MIR16 monoclonal antibody (M04), clone 2H6

Ref: AB-H00051573-M04
MIR16 monoclonal antibody (M04), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MIR16.
Información adicional
Size 100 ug
Gene Name GDE1
Gene Alias 363E6.2|MIR16
Gene Description glycerophosphodiester phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq ACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MIR16 (NP_057725, 31 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51573
Clone Number 2H6
Iso type IgG2a Kappa

Enviar un mensaje


MIR16 monoclonal antibody (M04), clone 2H6

MIR16 monoclonal antibody (M04), clone 2H6