MIR16 polyclonal antibody (A01)
  • MIR16 polyclonal antibody (A01)

MIR16 polyclonal antibody (A01)

Ref: AB-H00051573-A01
MIR16 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MIR16.
Información adicional
Size 50 uL
Gene Name GDE1
Gene Alias 363E6.2|MIR16
Gene Description glycerophosphodiester phosphodiesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MIR16 (NP_057725, 31 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51573

Enviar un mensaje


MIR16 polyclonal antibody (A01)

MIR16 polyclonal antibody (A01)