ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)

ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051566-D01P
ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARMCX3 protein.
Información adicional
Size 100 ug
Gene Name ARMCX3
Gene Alias ALEX3|DKFZp781N1954|KIAA0443|MGC12199|dJ545K15.2
Gene Description armadillo repeat containing, X-linked 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARMCX3 (NP_057691.1, 1 a.a. ~ 379 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51566

Enviar un mensaje


ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)

ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)