IL23A MaxPab rabbit polyclonal antibody (D01)
  • IL23A MaxPab rabbit polyclonal antibody (D01)

IL23A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051561-D01
IL23A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL23A protein.
Información adicional
Size 100 uL
Gene Name IL23A
Gene Alias IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF
Gene Description interleukin 23, alpha subunit p19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51561

Enviar un mensaje


IL23A MaxPab rabbit polyclonal antibody (D01)

IL23A MaxPab rabbit polyclonal antibody (D01)