CINP purified MaxPab mouse polyclonal antibody (B01P)
  • CINP purified MaxPab mouse polyclonal antibody (B01P)

CINP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051550-B01P
CINP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CINP protein.
Información adicional
Size 50 ug
Gene Name CINP
Gene Alias MGC849
Gene Description cyclin-dependent kinase 2-interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CINP (NP_116019.1, 1 a.a. ~ 212 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51550

Enviar un mensaje


CINP purified MaxPab mouse polyclonal antibody (B01P)

CINP purified MaxPab mouse polyclonal antibody (B01P)