SIRT6 monoclonal antibody (M01), clone 1D8
  • SIRT6 monoclonal antibody (M01), clone 1D8

SIRT6 monoclonal antibody (M01), clone 1D8

Ref: AB-H00051548-M01
SIRT6 monoclonal antibody (M01), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIRT6.
Información adicional
Size 100 ug
Gene Name SIRT6
Gene Alias SIR2L6
Gene Description sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT6 (NP_057623.1, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51548
Clone Number 1D8
Iso type IgG2a Kappa

Enviar un mensaje


SIRT6 monoclonal antibody (M01), clone 1D8

SIRT6 monoclonal antibody (M01), clone 1D8