SIRT6 purified MaxPab mouse polyclonal antibody (B01P)
  • SIRT6 purified MaxPab mouse polyclonal antibody (B01P)

SIRT6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051548-B01P
SIRT6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRT6 protein.
Información adicional
Size 50 ug
Gene Name SIRT6
Gene Alias SIR2L6
Gene Description sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSNVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRT6 (AAH28220.1, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51548

Enviar un mensaje


SIRT6 purified MaxPab mouse polyclonal antibody (B01P)

SIRT6 purified MaxPab mouse polyclonal antibody (B01P)