ZNF581 MaxPab mouse polyclonal antibody (B01P)
  • ZNF581 MaxPab mouse polyclonal antibody (B01P)

ZNF581 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051545-B01P
ZNF581 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF581 protein.
Información adicional
Size 50 ug
Gene Name ZNF581
Gene Alias FLJ22550|HSPC189
Gene Description zinc finger protein 581
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF581 (NP_057619.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51545

Enviar un mensaje


ZNF581 MaxPab mouse polyclonal antibody (B01P)

ZNF581 MaxPab mouse polyclonal antibody (B01P)