MTP18 MaxPab rabbit polyclonal antibody (D01)
  • MTP18 MaxPab rabbit polyclonal antibody (D01)

MTP18 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051537-D01
MTP18 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MTP18 protein.
Información adicional
Size 100 uL
Gene Name MTP18
Gene Alias HSPC242
Gene Description mitochondrial protein 18 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTP18 (NP_057582.2, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51537

Enviar un mensaje


MTP18 MaxPab rabbit polyclonal antibody (D01)

MTP18 MaxPab rabbit polyclonal antibody (D01)