MTP18 purified MaxPab mouse polyclonal antibody (B01P)
  • MTP18 purified MaxPab mouse polyclonal antibody (B01P)

MTP18 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051537-B01P
MTP18 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MTP18 protein.
Información adicional
Size 50 ug
Gene Name MTP18
Gene Alias HSPC242
Gene Description mitochondrial protein 18 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTP18 (NP_057582.2, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51537

Enviar un mensaje


MTP18 purified MaxPab mouse polyclonal antibody (B01P)

MTP18 purified MaxPab mouse polyclonal antibody (B01P)