PHF7 monoclonal antibody (M11), clone 1A7
  • PHF7 monoclonal antibody (M11), clone 1A7

PHF7 monoclonal antibody (M11), clone 1A7

Ref: AB-H00051533-M11
PHF7 monoclonal antibody (M11), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHF7.
Información adicional
Size 100 ug
Gene Name PHF7
Gene Alias DKFZp434L1850|HSPC045|HSPC226|MGC26088|NYD-SP6
Gene Description PHD finger protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF7 (NP_057567.3, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51533
Clone Number 1A7
Iso type IgG2a Kappa

Enviar un mensaje


PHF7 monoclonal antibody (M11), clone 1A7

PHF7 monoclonal antibody (M11), clone 1A7