PHF7 purified MaxPab mouse polyclonal antibody (B01P)
  • PHF7 purified MaxPab mouse polyclonal antibody (B01P)

PHF7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051533-B01P
PHF7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PHF7 protein.
Información adicional
Size 50 ug
Gene Name PHF7
Gene Alias DKFZp434L1850|HSPC045|HSPC226|MGC26088|NYD-SP6
Gene Description PHD finger protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PHF7 (NP_057567.3, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51533

Enviar un mensaje


PHF7 purified MaxPab mouse polyclonal antibody (B01P)

PHF7 purified MaxPab mouse polyclonal antibody (B01P)