ETV7 MaxPab rabbit polyclonal antibody (D01)
  • ETV7 MaxPab rabbit polyclonal antibody (D01)

ETV7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051513-D01
ETV7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ETV7 protein.
Información adicional
Size 100 uL
Gene Name ETV7
Gene Alias TEL-2|TEL2|TELB
Gene Description ets variant 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ETV7 (NP_057219.1, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51513

Enviar un mensaje


ETV7 MaxPab rabbit polyclonal antibody (D01)

ETV7 MaxPab rabbit polyclonal antibody (D01)