GTSE1 polyclonal antibody (A01)
  • GTSE1 polyclonal antibody (A01)

GTSE1 polyclonal antibody (A01)

Ref: AB-H00051512-A01
GTSE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTSE1.
Información adicional
Size 50 uL
Gene Name GTSE1
Gene Alias B99
Gene Description G-2 and S-phase expressed 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PSEALLVDIKLEPLAVTPDAASQPLIDLPLIDFCDTPEAHVAVGSESRPLIDLMTNTPDMNKNVAKPSPVVGQLIDLSSPLIQLSPEADKENVDSPLLKF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTSE1 (NP_057510, 621 a.a. ~ 720 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51512

Enviar un mensaje


GTSE1 polyclonal antibody (A01)

GTSE1 polyclonal antibody (A01)