UFC1 purified MaxPab mouse polyclonal antibody (B01P)
  • UFC1 purified MaxPab mouse polyclonal antibody (B01P)

UFC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051506-B01P
UFC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UFC1 protein.
Información adicional
Size 50 ug
Gene Name UFC1
Gene Alias HSPC155
Gene Description ubiquitin-fold modifier conjugating enzyme 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UFC1 (AAH05187.1, 1 a.a. ~ 167 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51506

Enviar un mensaje


UFC1 purified MaxPab mouse polyclonal antibody (B01P)

UFC1 purified MaxPab mouse polyclonal antibody (B01P)