HSPC152 monoclonal antibody (M09), clone 3E5
  • HSPC152 monoclonal antibody (M09), clone 3E5

HSPC152 monoclonal antibody (M09), clone 3E5

Ref: AB-H00051504-M09
HSPC152 monoclonal antibody (M09), clone 3E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HSPC152.
Información adicional
Size 100 ug
Gene Name HSPC152
Gene Alias -
Gene Description hypothetical protein HSPC152
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPC152 (AAH17172, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51504
Clone Number 3E5
Iso type IgG2a Kappa

Enviar un mensaje


HSPC152 monoclonal antibody (M09), clone 3E5

HSPC152 monoclonal antibody (M09), clone 3E5