HSPC152 purified MaxPab mouse polyclonal antibody (B01P)
  • HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051504-B01P
HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HSPC152 protein.
Información adicional
Size 50 ug
Gene Name HSPC152
Gene Alias -
Gene Description hypothetical protein HSPC152
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPC152 (NP_057488.1, 1 a.a. ~ 125 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51504

Enviar un mensaje


HSPC152 purified MaxPab mouse polyclonal antibody (B01P)

HSPC152 purified MaxPab mouse polyclonal antibody (B01P)