HSPC121 polyclonal antibody (A01)
  • HSPC121 polyclonal antibody (A01)

HSPC121 polyclonal antibody (A01)

Ref: AB-H00051495-A01
HSPC121 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HSPC121.
Información adicional
Size 50 uL
Gene Name PTPLAD1
Gene Alias B-IND1|FLJ90376|HSPC121
Gene Description protein tyrosine phosphatase-like A domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSPC121 (NP_057479, 1 a.a. ~ 113 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51495

Enviar un mensaje


HSPC121 polyclonal antibody (A01)

HSPC121 polyclonal antibody (A01)