NOP16 MaxPab rabbit polyclonal antibody (D01)
  • NOP16 MaxPab rabbit polyclonal antibody (D01)

NOP16 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051491-D01
NOP16 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NOP16 protein.
Información adicional
Size 100 uL
Gene Name NOP16
Gene Alias HSPC111|HSPC185
Gene Description NOP16 nucleolar protein homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOP16 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51491

Enviar un mensaje


NOP16 MaxPab rabbit polyclonal antibody (D01)

NOP16 MaxPab rabbit polyclonal antibody (D01)