VCX3A monoclonal antibody (M01), clone 6A3
  • VCX3A monoclonal antibody (M01), clone 6A3

VCX3A monoclonal antibody (M01), clone 6A3

Ref: AB-H00051481-M01
VCX3A monoclonal antibody (M01), clone 6A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VCX3A.
Información adicional
Size 100 ug
Gene Name VCX3A
Gene Alias MGC118976|MGC125730|MGC125796|VCX-8r|VCX-A|VCX3|VCX8R|VCXA
Gene Description variable charge, X-linked 3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VCX3A (NP_057463, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51481
Clone Number 6A3
Iso type IgG2a Kappa

Enviar un mensaje


VCX3A monoclonal antibody (M01), clone 6A3

VCX3A monoclonal antibody (M01), clone 6A3