VCX3A purified MaxPab mouse polyclonal antibody (B01P)
  • VCX3A purified MaxPab mouse polyclonal antibody (B01P)

VCX3A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051481-B01P
VCX3A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VCX3A protein.
Información adicional
Size 50 ug
Gene Name VCX3A
Gene Alias MGC118976|MGC125730|MGC125796|VCX-8r|VCX-A|VCX3|VCX8R|VCXA
Gene Description variable charge, X-linked 3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VCX3A (AAH98149.1, 1 a.a. ~ 166 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51481

Enviar un mensaje


VCX3A purified MaxPab mouse polyclonal antibody (B01P)

VCX3A purified MaxPab mouse polyclonal antibody (B01P)