DCDC2 polyclonal antibody (A01)
  • DCDC2 polyclonal antibody (A01)

DCDC2 polyclonal antibody (A01)

Ref: AB-H00051473-A01
DCDC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DCDC2.
Información adicional
Size 50 uL
Gene Name DCDC2
Gene Alias DCDC2A|RU2|RU2S
Gene Description doublecortin domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DCDC2 (NP_057440, 377 a.a. ~ 476 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51473

Enviar un mensaje


DCDC2 polyclonal antibody (A01)

DCDC2 polyclonal antibody (A01)