EVL monoclonal antibody (M02), clone 1D6
  • EVL monoclonal antibody (M02), clone 1D6

EVL monoclonal antibody (M02), clone 1D6

Ref: AB-H00051466-M02
EVL monoclonal antibody (M02), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EVL.
Información adicional
Size 100 ug
Gene Name EVL
Gene Alias RNB6
Gene Description Enah/Vasp-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVL (NP_057421, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51466
Clone Number 1D6
Iso type IgG2a Kappa

Enviar un mensaje


EVL monoclonal antibody (M02), clone 1D6

EVL monoclonal antibody (M02), clone 1D6