EVL monoclonal antibody (M01), clone 5G1
  • EVL monoclonal antibody (M01), clone 5G1

EVL monoclonal antibody (M01), clone 5G1

Ref: AB-H00051466-M01
EVL monoclonal antibody (M01), clone 5G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EVL.
Información adicional
Size 100 ug
Gene Name EVL
Gene Alias RNB6
Gene Description Enah/Vasp-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVL (NP_057421, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51466
Clone Number 5G1
Iso type IgG2a Kappa

Enviar un mensaje


EVL monoclonal antibody (M01), clone 5G1

EVL monoclonal antibody (M01), clone 5G1