UBE2J1 polyclonal antibody (A01)
  • UBE2J1 polyclonal antibody (A01)

UBE2J1 polyclonal antibody (A01)

Ref: AB-H00051465-A01
UBE2J1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2J1.
Información adicional
Size 50 uL
Gene Name UBE2J1
Gene Alias CGI-76|HSPC153|HSPC205|HSU93243|MGC12555|NCUBE1|Ubc6p
Gene Description ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2J1 (NP_003329, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51465

Enviar un mensaje


UBE2J1 polyclonal antibody (A01)

UBE2J1 polyclonal antibody (A01)