GULP1 polyclonal antibody (A01)
  • GULP1 polyclonal antibody (A01)

GULP1 polyclonal antibody (A01)

Ref: AB-H00051454-A01
GULP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GULP1.
Información adicional
Size 50 uL
Gene Name GULP1
Gene Alias CED-6|CED6|FLJ31156|GULP
Gene Description GULP, engulfment adaptor PTB domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GULP1 (AAH01103, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51454

Enviar un mensaje


GULP1 polyclonal antibody (A01)

GULP1 polyclonal antibody (A01)