LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)

LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051451-D01P
LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LCMT1 protein.
Información adicional
Size 100 ug
Gene Name LCMT1
Gene Alias CGI-68|LCMT|PPMT1
Gene Description leucine carboxyl methyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LCMT1 (NP_057393.2, 1 a.a. ~ 334 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51451

Enviar un mensaje


LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)

LCMT1 purified MaxPab rabbit polyclonal antibody (D01P)