PCYOX1 polyclonal antibody (A01)
  • PCYOX1 polyclonal antibody (A01)

PCYOX1 polyclonal antibody (A01)

Ref: AB-H00051449-A01
PCYOX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PCYOX1.
Información adicional
Size 50 uL
Gene Name PCYOX1
Gene Alias KIAA0908|PCL1
Gene Description prenylcysteine oxidase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKDVKIDLFEREEVGGRLATMMVQGQEYEAGGSVIHPLNLHMKRFVKDLGLSAVQASGGLLGIHNGETLVFEESNWFIINVIKLVWRYGFQSLRMHMWVEDVLDKFMRIYRYQSHDYAFSSVEKLLHALGGDDFLGMLNRTLLETLQKAGFSEKFLNEMIAPVMRVNYGQSTDINAFVGAVSLSCSDSGLWAVEGGNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCYOX1 (AAH33815, 1 a.a. ~ 505 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51449

Enviar un mensaje


PCYOX1 polyclonal antibody (A01)

PCYOX1 polyclonal antibody (A01)