RNF138 monoclonal antibody (M01A), clone 3G2
  • RNF138 monoclonal antibody (M01A), clone 3G2

RNF138 monoclonal antibody (M01A), clone 3G2

Ref: AB-H00051444-M01A
RNF138 monoclonal antibody (M01A), clone 3G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF138.
Información adicional
Size 200 uL
Gene Name RNF138
Gene Alias HSD-4|MGC8758|NARF|STRIN
Gene Description ring finger protein 138
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF138 (NP_055369, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 51444
Clone Number 3G2
Iso type IgM Kappa

Enviar un mensaje


RNF138 monoclonal antibody (M01A), clone 3G2

RNF138 monoclonal antibody (M01A), clone 3G2