VGLL1 purified MaxPab mouse polyclonal antibody (B02P)
  • VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051442-B02P
VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VGLL1 protein.
Información adicional
Size 50 ug
Gene Name VGLL1
Gene Alias TDU|VGL1
Gene Description vestigial like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VGLL1 (NP_057351.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51442

Enviar un mensaje


VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

VGLL1 purified MaxPab mouse polyclonal antibody (B02P)