ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)
  • ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)

ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051433-B01P
ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANAPC5 protein.
Información adicional
Size 50 ug
Gene Name ANAPC5
Gene Alias APC5
Gene Description anaphase promoting complex subunit 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANAPC5 (NP_057321.2, 1 a.a. ~ 755 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51433

Enviar un mensaje


ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)

ANAPC5 purified MaxPab mouse polyclonal antibody (B01P)