PRKAG2 monoclonal antibody (M01), clone 3C4
  • PRKAG2 monoclonal antibody (M01), clone 3C4

PRKAG2 monoclonal antibody (M01), clone 3C4

Ref: AB-H00051422-M01
PRKAG2 monoclonal antibody (M01), clone 3C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKAG2.
Información adicional
Size 100 ug
Gene Name PRKAG2
Gene Alias AAKG|AAKG2|CMH6|H91620p|WPWS
Gene Description protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA,IF
Immunogen Prot. Seq AFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKAG2 (AAH20540, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51422
Clone Number 3C4
Iso type IgG2a Kappa

Enviar un mensaje


PRKAG2 monoclonal antibody (M01), clone 3C4

PRKAG2 monoclonal antibody (M01), clone 3C4