PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)
  • PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)

PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051422-B01P
PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRKAG2 protein.
Información adicional
Size 50 ug
Gene Name PRKAG2
Gene Alias AAKG|AAKG2|CMH6|H91620p|WPWS
Gene Description protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAG2 (NP_077747.1, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51422

Enviar un mensaje


PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)

PRKAG2 purified MaxPab mouse polyclonal antibody (B01P)