C2orf28 monoclonal antibody (M11), clone 1D2
  • C2orf28 monoclonal antibody (M11), clone 1D2

C2orf28 monoclonal antibody (M11), clone 1D2

Ref: AB-H00051374-M11
C2orf28 monoclonal antibody (M11), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant C2orf28.
Información adicional
Size 100 ug
Gene Name C2orf28
Gene Alias APR--3|APR-3|APR3|HSPC013|PRO240|p18
Gene Description chromosome 2 open reading frame 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C2orf28 (AAH11006, 1 a.a. ~ 171 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51374
Clone Number 1D2
Iso type IgG2a Kappa

Enviar un mensaje


C2orf28 monoclonal antibody (M11), clone 1D2

C2orf28 monoclonal antibody (M11), clone 1D2