PLA1A MaxPab rabbit polyclonal antibody (D01)
  • PLA1A MaxPab rabbit polyclonal antibody (D01)

PLA1A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051365-D01
PLA1A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLA1A protein.
Información adicional
Size 100 uL
Gene Name PLA1A
Gene Alias PS-PLA1|PSPLA1
Gene Description phospholipase A1 member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLA1A (NP_056984.1, 1 a.a. ~ 456 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51365

Enviar un mensaje


PLA1A MaxPab rabbit polyclonal antibody (D01)

PLA1A MaxPab rabbit polyclonal antibody (D01)