PLA1A polyclonal antibody (A01)
  • PLA1A polyclonal antibody (A01)

PLA1A polyclonal antibody (A01)

Ref: AB-H00051365-A01
PLA1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLA1A.
Información adicional
Size 50 uL
Gene Name PLA1A
Gene Alias PS-PLA1|PSPLA1
Gene Description phospholipase A1 member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLA1A (NP_056984, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51365

Enviar un mensaje


PLA1A polyclonal antibody (A01)

PLA1A polyclonal antibody (A01)