CDC40 MaxPab mouse polyclonal antibody (B01P)
  • CDC40 MaxPab mouse polyclonal antibody (B01P)

CDC40 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051362-B01P
CDC40 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CDC40 protein.
Información adicional
Size 50 ug
Gene Name CDC40
Gene Alias EHB3|FLJ10564|MGC102802|PRP17|PRPF17
Gene Description cell division cycle 40 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC40 (NP_056975, 1 a.a. ~ 579 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51362

Enviar un mensaje


CDC40 MaxPab mouse polyclonal antibody (B01P)

CDC40 MaxPab mouse polyclonal antibody (B01P)