HOOK1 polyclonal antibody (A01)
  • HOOK1 polyclonal antibody (A01)

HOOK1 polyclonal antibody (A01)

Ref: AB-H00051361-A01
HOOK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HOOK1.
Información adicional
Size 50 uL
Gene Name HOOK1
Gene Alias HK1|MGC10642
Gene Description hook homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MLLRKQLAEKERRIEILESECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTPARSFLAQQRHITNTRRNLSVKVPATTSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HOOK1 (NP_056972, 632 a.a. ~ 728 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51361

Enviar un mensaje


HOOK1 polyclonal antibody (A01)

HOOK1 polyclonal antibody (A01)