TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)
  • TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051330-B01P
TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFRSF12A protein.
Información adicional
Size 50 ug
Gene Name TNFRSF12A
Gene Alias CD266|FN14|TWEAKR
Gene Description tumor necrosis factor receptor superfamily, member 12A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF12A (ABM87215.1, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51330

Enviar un mensaje


TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)

TNFRSF12A purified MaxPab mouse polyclonal antibody (B01P)