ERAF monoclonal antibody (M32), clone 2E4
  • ERAF monoclonal antibody (M32), clone 2E4

ERAF monoclonal antibody (M32), clone 2E4

Ref: AB-H00051327-M32
ERAF monoclonal antibody (M32), clone 2E4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ERAF.
Información adicional
Size 100 ug
Gene Name ERAF
Gene Alias AHSP|EDRF
Gene Description erythroid associated factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ERAF (NP_057717.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51327
Clone Number 2E4
Iso type IgG1 Kappa

Enviar un mensaje


ERAF monoclonal antibody (M32), clone 2E4

ERAF monoclonal antibody (M32), clone 2E4