SPG21 polyclonal antibody (A01)
  • SPG21 polyclonal antibody (A01)

SPG21 polyclonal antibody (A01)

Ref: AB-H00051324-A01
SPG21 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPG21.
Información adicional
Size 50 uL
Gene Name SPG21
Gene Alias ACP33|BM-019|GL010|MASPARDIN|MAST
Gene Description spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPG21 (NP_057714, 211 a.a. ~ 306 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51324

Enviar un mensaje


SPG21 polyclonal antibody (A01)

SPG21 polyclonal antibody (A01)