PHF21A monoclonal antibody (M01), clone 5A6
  • PHF21A monoclonal antibody (M01), clone 5A6

PHF21A monoclonal antibody (M01), clone 5A6

Ref: AB-H00051317-M01
PHF21A monoclonal antibody (M01), clone 5A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHF21A.
Información adicional
Size 100 ug
Gene Name PHF21A
Gene Alias BHC80|BM-006|KIAA1696
Gene Description PHD finger protein 21A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF21A (NP_057705, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51317
Clone Number 5A6
Iso type IgG1 Kappa

Enviar un mensaje


PHF21A monoclonal antibody (M01), clone 5A6

PHF21A monoclonal antibody (M01), clone 5A6