TXNDC3 monoclonal antibody (M01), clone 1G5
  • TXNDC3 monoclonal antibody (M01), clone 1G5

TXNDC3 monoclonal antibody (M01), clone 1G5

Ref: AB-H00051314-M01
TXNDC3 monoclonal antibody (M01), clone 1G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TXNDC3.
Información adicional
Size 100 ug
Gene Name TXNDC3
Gene Alias CILD6|NME8|SPTRX2
Gene Description thioredoxin domain containing 3 (spermatozoa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AEWRRLMGPTDPEEAKLLSPDSIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TXNDC3 (NP_057700, 530 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51314
Clone Number 1G5
Iso type IgG2a Kappa

Enviar un mensaje


TXNDC3 monoclonal antibody (M01), clone 1G5

TXNDC3 monoclonal antibody (M01), clone 1G5