TLR8 monoclonal antibody (M05), clone 4C1
  • TLR8 monoclonal antibody (M05), clone 4C1

TLR8 monoclonal antibody (M05), clone 4C1

Ref: AB-H00051311-M05
TLR8 monoclonal antibody (M05), clone 4C1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TLR8.
Información adicional
Size 100 ug
Gene Name TLR8
Gene Alias CD288|MGC119599|MGC119600
Gene Description toll-like receptor 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR8 (NP_619542, 723 a.a. ~ 825 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51311
Clone Number 4C1
Iso type IgG2b Kappa

Enviar un mensaje


TLR8 monoclonal antibody (M05), clone 4C1

TLR8 monoclonal antibody (M05), clone 4C1