FKBP11 purified MaxPab mouse polyclonal antibody (B01P)
  • FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051303-B01P
FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FKBP11 protein.
Información adicional
Size 50 ug
Gene Name FKBP11
Gene Alias FKBP19|MGC54182
Gene Description FK506 binding protein 11, 19 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FKBP11 (NP_057678.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51303

Enviar un mensaje


FKBP11 purified MaxPab mouse polyclonal antibody (B01P)

FKBP11 purified MaxPab mouse polyclonal antibody (B01P)