GCNT4 purified MaxPab mouse polyclonal antibody (B01P)
  • GCNT4 purified MaxPab mouse polyclonal antibody (B01P)

GCNT4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051301-B01P
GCNT4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GCNT4 protein.
Información adicional
Size 50 ug
Gene Name GCNT4
Gene Alias C2GNT3
Gene Description glucosaminyl (N-acetyl) transferase 4, core 2 (beta-1,6-N-acetylglucosaminyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRYTHVKDEVRYEVNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYAQKLVSKEEKSFPIAYSLVVHKDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCLSDLLKSSIQWKYVINLCGQDFPLKSNFELVSELKKLNGANMLETV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GCNT4 (NP_057675.1, 1 a.a. ~ 453 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51301

Enviar un mensaje


GCNT4 purified MaxPab mouse polyclonal antibody (B01P)

GCNT4 purified MaxPab mouse polyclonal antibody (B01P)