SLC15A3 monoclonal antibody (M04), clone 5B4
  • SLC15A3 monoclonal antibody (M04), clone 5B4

SLC15A3 monoclonal antibody (M04), clone 5B4

Ref: AB-H00051296-M04
SLC15A3 monoclonal antibody (M04), clone 5B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC15A3.
Información adicional
Size 100 ug
Gene Name SLC15A3
Gene Alias FLJ26631|OCTP|PHT2|PTR3|hPTR3
Gene Description solute carrier family 15, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC15A3 (NP_057666.1, 254 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51296
Clone Number 5B4
Iso type IgG2b Kappa

Enviar un mensaje


SLC15A3 monoclonal antibody (M04), clone 5B4

SLC15A3 monoclonal antibody (M04), clone 5B4