Ver mas grande
TLR7 monoclonal antibody (M08), clone 2F6
AB-H00051284-M08
Producto nuevo
TLR7 monoclonal antibody (M08), clone 2F6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TLR7 |
| Gene Alias | - |
| Gene Description | toll-like receptor 7 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TLR7 (NP_057646, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 51284 |
| Clone Number | 2F6 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TLR7.