GOLM1 purified MaxPab mouse polyclonal antibody (B01P)
  • GOLM1 purified MaxPab mouse polyclonal antibody (B01P)

GOLM1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051280-B01P
GOLM1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GOLM1 protein.
Información adicional
Size 50 ug
Gene Name GOLM1
Gene Alias C9orf155|FLJ22634|FLJ23608|GOLPH2|GP73|PSEC0257|bA379P1.3
Gene Description golgi membrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GOLM1 (NP_057632.2, 1 a.a. ~ 401 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51280

Enviar un mensaje


GOLM1 purified MaxPab mouse polyclonal antibody (B01P)

GOLM1 purified MaxPab mouse polyclonal antibody (B01P)